DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cabp2a

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001025439.2 Gene:cabp2a / 572226 ZFINID:ZDB-GENE-050913-25 Length:236 Species:Danio rerio


Alignment Length:147 Identity:45/147 - (30%)
Similarity:76/147 - (51%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |..|::::.:.||..||.|....|..|.|.:|:|.:.:.|.|.|:.:...:|   ..|.:...||
Zfish    91 LRPEEIEELKEAFREFDKDKDGFISCKDLGECMRTMGYMPTEMELIELSQQI---CGGRVDFEDF 152

  Fly    86 LYIMSKRYENLTVE----DEVILAFKVFDKDGSGFIHENEFRQIMTE-YGDEMEEDEIEEMIRDA 145
            :.:|..:....|.:    .|:..||:.||.:|.|.|...|.|:.|.: .|:::...||:|::||.
Zfish   153 VDLMGPKMLAETADMIGVKELRDAFREFDSNGDGQISLAELREAMKKLMGEQLNHREIDEILRDV 217

  Fly   146 DANTELKIDYVRFVTMM 162
            |.|.:..:|:..||.||
Zfish   218 DLNGDGLVDFEEFVRMM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 45/147 (31%)
EFh 28..90 CDD:298682 17/61 (28%)
EFh 64..127 CDD:238008 17/66 (26%)
EFh 101..163 CDD:298682 24/63 (38%)
cabp2aNP_001025439.2 PTZ00184 91..234 CDD:185504 43/145 (30%)
EFh 98..198 CDD:238008 29/102 (28%)
EFh 172..235 CDD:238008 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.