DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and calml4a

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001124246.1 Gene:calml4a / 560151 ZFINID:ZDB-GENE-081022-9 Length:153 Species:Danio rerio


Alignment Length:142 Identity:36/142 - (25%)
Similarity:73/142 - (51%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |:..|:.:.:..|:|:|......|..|.|...:|.:..:|..||:..::.....|.:|||..|.|
Zfish     5 LSQNQIDEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTYNEVDRHLQVHKIDKTGELDFSTF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |.:|.::.:....:.|::.|.::.||...|:|..:|.|..:|..|:::.:.|::|:.::|....:
Zfish    70 LTMMHRQMQQEDPKTEILEAMRMTDKHKKGYIQASELRAKLTGLGEKLTDKEVDELFKEAHVGRD 134

  Fly   151 LKIDYVRFVTMM 162
            ..:.|..|..|:
Zfish   135 GLVHYEEFTRMV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 36/142 (25%)
EFh 28..90 CDD:298682 17/61 (28%)
EFh 64..127 CDD:238008 17/62 (27%)
EFh 101..163 CDD:298682 16/62 (26%)
calml4aNP_001124246.1 PTZ00184 1..147 CDD:185504 36/142 (25%)
EFh 12..74 CDD:238008 17/61 (28%)
EFh 85..147 CDD:238008 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.