DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cabp5b

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001018568.1 Gene:cabp5b / 553766 ZFINID:ZDB-GENE-050522-146 Length:169 Species:Danio rerio


Alignment Length:150 Identity:46/150 - (30%)
Similarity:73/150 - (48%) Gaps:11/150 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |.||::.:...||..||.|...:|..|.|.:.:|.:.:.|.|.|:.:....|:.:..|.:...||
Zfish    20 LADEEIDELREAFTEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELSQNINMNLGGSVDFQDF 84

  Fly    86 LYIMSKRYENLTVE-------DEVILAFKVFDKDGSGFIHENEFRQIMTE-YGDEMEEDEIEEMI 142
            :.:|:.:   |..|       .|:..|||.||.||.|.|...|.|..|.: .|:.....|:|.::
Zfish    85 VDLMAPK---LLAETAGMIGIKELKDAFKEFDMDGDGSITTEELRLAMLKLLGENTNRREVEAVV 146

  Fly   143 RDADANTELKIDYVRFVTMM 162
            |:.|.|.:..:|:..||.||
Zfish   147 REVDNNGDGTVDFEEFVKMM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 45/149 (30%)
EFh 28..90 CDD:298682 16/61 (26%)
EFh 64..127 CDD:238008 20/69 (29%)
EFh 101..163 CDD:298682 23/62 (37%)
cabp5bNP_001018568.1 PTZ00184 20..166 CDD:185504 44/148 (30%)
EFh 27..89 CDD:238008 16/61 (26%)
EFh 104..167 CDD:238008 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.