DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CALML5

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_059118.2 Gene:CALML5 / 51806 HGNCID:18180 Length:146 Species:Homo sapiens


Alignment Length:144 Identity:44/144 - (30%)
Similarity:78/144 - (54%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |..|:....:.||:..|.|....|..:.|...|:|...|..|.:::..|:|:|:||.||:...:|
Human     5 LTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |....|....|   :::.:||:.||:||.|.|..:|.|:.|...|..:.::|::.|||:||.:.:
Human    70 LTAAKKARAGL---EDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQD 131

  Fly   151 LKIDYVRFVTMMME 164
            .:::|..|..|:.:
Human   132 GRVNYEEFARMLAQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 44/141 (31%)
EFh 28..90 CDD:298682 19/61 (31%)
EFh 64..127 CDD:238008 21/62 (34%)
EFh 101..163 CDD:298682 21/61 (34%)
CALML5NP_059118.2 PTZ00184 1..143 CDD:185504 43/140 (31%)
EFh 12..74 CDD:238008 19/61 (31%)
EFh 82..144 CDD:238008 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.