DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and calml4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001011117.1 Gene:calml4 / 496530 XenbaseID:XB-GENE-5936220 Length:153 Species:Xenopus tropicalis


Alignment Length:136 Identity:33/136 - (24%)
Similarity:66/136 - (48%) Gaps:3/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYI 88
            ::.|:|   |:|:|......||...|...:|.:...|...|:..::........||:..|.||.|
 Frog    11 QKFKEC---FSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKDGEVDFSTFLTI 72

  Fly    89 MSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKI 153
            |.::.:....|:|:::|..:.||...|.|...|.|..:|:.|:::..:|::::::......:..:
 Frog    73 MYRQQKQEDPENEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGVKVGPDGMV 137

  Fly   154 DYVRFV 159
            .|..||
 Frog   138 KYEEFV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 33/136 (24%)
EFh 28..90 CDD:298682 16/61 (26%)
EFh 64..127 CDD:238008 17/62 (27%)
EFh 101..163 CDD:298682 14/59 (24%)
calml4NP_001011117.1 PTZ00184 1..144 CDD:185504 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.