DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Calm5

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:148 Identity:38/148 - (25%)
Similarity:77/148 - (52%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 THTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYL 82
            :|....|:.||..             |.::.|.|.::.:..|....|::..|:::||||.|::..
Mouse     2 SHGFTKEENKDGH-------------INVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISF 53

  Fly    83 SDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADA 147
            .:|.    |..:..|.|.|:...|.|.|::|.|:|..:|.::.:::.|:.:.::|:|.||....|
Mouse    54 EEFF----KSIKKYTKEQELQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGA 114

  Fly   148 NTELKIDYVRFVTMMMET 165
            :.:.|::|.:|::..:||
Mouse   115 DQDGKVNYEQFLSHYIET 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 35/141 (25%)
EFh 28..90 CDD:298682 13/61 (21%)
EFh 64..127 CDD:238008 19/62 (31%)
EFh 101..163 CDD:298682 17/61 (28%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 13/58 (22%)
EFh 35..94 CDD:238008 19/62 (31%)
EF-hand_7 36..91 CDD:290234 18/58 (31%)
EFh 68..128 CDD:238008 17/59 (29%)
EF-hand_7 69..129 CDD:290234 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.