DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and MYL4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_011523141.2 Gene:MYL4 / 4635 HGNCID:7585 Length:228 Species:Homo sapiens


Alignment Length:141 Identity:41/141 - (29%)
Similarity:67/141 - (47%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AFALFDDDNAKVIPIKL--LRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF------LYI 88
            ||:|||......:.|..  ..|.|||:..||...|:...:.:...: ...:.:.||      |..
Human    90 AFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPE-EMNVKMLDFETFLPILQH 153

  Fly    89 MSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIR-DADANTELK 152
            :|:..|..|.|| .:...:||||:.:|.:...|.|.::...|::|.|.|:|:::. ..|||.  .
Human   154 ISRNKEQGTYED-FVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANG--C 215

  Fly   153 IDYVRFVTMMM 163
            |:|..||..:|
Human   216 INYEAFVKHIM 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 40/139 (29%)
EFh 28..90 CDD:298682 16/65 (25%)
EFh 64..127 CDD:238008 16/68 (24%)
EFh 101..163 CDD:298682 19/62 (31%)
MYL4XP_011523141.2 EFh_PEF 86..227 CDD:330173 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.