DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and MYL1

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:146 Identity:43/146 - (29%)
Similarity:72/146 - (49%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTD--GSGELYLSDFL 86
            ||..:.:.||.|||......|.:..:.|.|||:..||...|::..:.....:  .:.::....||
Human    50 EQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL 114

  Fly    87 YIM---SKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEE-MIRDADA 147
            .:|   |...:..|.|| .:...:||||:|:|.:...|.|.::...|::|:|:|:|. |....|:
Human   115 PMMQAISNNKDQATYED-FVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDS 178

  Fly   148 NTELKIDYVRFVTMMM 163
            |.  .|:|..||..:|
Human   179 NG--CINYEAFVKHIM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 42/144 (29%)
EFh 28..90 CDD:298682 16/66 (24%)
EFh 64..127 CDD:238008 16/67 (24%)
EFh 101..163 CDD:298682 20/62 (32%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 43/146 (29%)
EFh 54..118 CDD:298682 15/63 (24%)
EF-hand_6 54..83 CDD:290141 10/28 (36%)
EFh 131..192 CDD:238008 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.