DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG17770

DIOPT Version :10

Sequence 1:NP_651431.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:163 Identity:96/163 - (58%)
Similarity:126/163 - (77%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQD 67
            ||:|.:||||.||:.||.|.:||:||.|.||:||||.:.|||||..||..:.:|||.|.:.|:|:
  Fly     2 DFEFLTPPPEERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQE 66

  Fly    68 YITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDE 132
            ...|||.||||||||||||:|||:||.|::.|||:|.||:||||:|:|.|.|:|||.||...|::
  Fly    67 IQAEIDADGSGELYLSDFLHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQ 131

  Fly   133 MEEDEIEEMIRDADANTELKIDYVRFVTMMMET 165
            :.:||:||:||||:::.|..|||||||.||..|
  Fly   132 LTDDEVEEIIRDANSDLEGNIDYVRFVRMMSTT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_651431.1 PTZ00184 21..163 CDD:185504 83/141 (59%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 82/141 (58%)

Return to query results.
Submit another query.