DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG17770

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:163 Identity:96/163 - (58%)
Similarity:126/163 - (77%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQD 67
            ||:|.:||||.||:.||.|.:||:||.|.||:||||.:.|||||..||..:.:|||.|.:.|:|:
  Fly     2 DFEFLTPPPEERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQE 66

  Fly    68 YITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDE 132
            ...|||.||||||||||||:|||:||.|::.|||:|.||:||||:|:|.|.|:|||.||...|::
  Fly    67 IQAEIDADGSGELYLSDFLHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQ 131

  Fly   133 MEEDEIEEMIRDADANTELKIDYVRFVTMMMET 165
            :.:||:||:||||:::.|..|||||||.||..|
  Fly   132 LTDDEVEEIIRDANSDLEGNIDYVRFVRMMSTT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 83/141 (59%)
EFh 28..90 CDD:298682 37/61 (61%)
EFh 64..127 CDD:238008 41/62 (66%)
EFh 101..163 CDD:298682 35/61 (57%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 82/141 (58%)
EFh 27..89 CDD:298682 37/61 (61%)
EFh 63..126 CDD:238008 41/62 (66%)
EFh 100..162 CDD:238008 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
76.850

Return to query results.
Submit another query.