DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG17272

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:136 Identity:33/136 - (24%)
Similarity:68/136 - (50%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYI 88
            ::.::|...||    .:.::..:..|...:|::..:|...|:..|:.:    .:|::..:|||.|
  Fly    11 DEFRECFYLFA----RSGQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADFLDI 67

  Fly    89 MSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKI 153
            |.:..:..::.||||.|||..|....|.|...:.|.::..:|:.:...|::.:.|:|:.|....:
  Fly    68 MHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTV 132

  Fly   154 DYVRFV 159
            .|..||
  Fly   133 RYADFV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 33/136 (24%)
EFh 28..90 CDD:298682 13/61 (21%)
EFh 64..127 CDD:238008 19/62 (31%)
EFh 101..163 CDD:298682 18/59 (31%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.