DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and myl3

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_989012.1 Gene:myl3 / 394608 XenbaseID:XB-GENE-946570 Length:188 Species:Xenopus tropicalis


Alignment Length:168 Identity:48/168 - (28%)
Similarity:79/168 - (47%) Gaps:18/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPE----VRTVHTHTLNDEQLKDCEAAFALFD--DDNAKVIPIKLLRDCLRAVAHNPPENEIQD 67
            ||.|    ..|| |...:.:|:::.:.||:|||  ....:.|......|.|||:..||...|:..
 Frog    24 PPKEPLFDPSTV-TIEFSADQIEEFKEAFSLFDRTPKCEQKITYGQCGDVLRALGQNPTNAEVLK 87

  Fly    68 YITEIDTDGSGELYLSDF------LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIM 126
            .:.:...: ...|.|.||      |..:||..|..|.|| .:...:||||:|:|.:...|.|.::
 Frog    88 VLGKPKAE-ELSLKLMDFDTFLPMLQHISKSKEKGTYED-FVEGLRVFDKEGNGTVMGAEIRHVL 150

  Fly   127 TEYGDEMEEDEIEEMIR-DADANTELKIDYVRFVTMMM 163
            ...|:.|.|:|::.::: ..|.|..  |:|..|...::
 Frog   151 ATLGERMTEEEVDRLLQGQEDPNGH--INYEAFAKYIL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 42/150 (28%)
EFh 28..90 CDD:298682 18/69 (26%)
EFh 64..127 CDD:238008 20/68 (29%)
EFh 101..163 CDD:298682 17/62 (27%)
myl3NP_989012.1 PTZ00184 37..188 CDD:185504 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.