DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and myl1

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_988954.1 Gene:myl1 / 394551 XenbaseID:XB-GENE-970333 Length:190 Species:Xenopus tropicalis


Alignment Length:166 Identity:45/166 - (27%)
Similarity:77/166 - (46%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDY 68
            ||.||...|        .:.:|..|.:.||.|||......|.:..:.|.:||:..||...|::..
 Frog    34 FDLSSVKIE--------FSQDQQDDFKEAFLLFDRTGDSKIALNQVADVMRALGQNPTNAEVKKV 90

  Fly    69 ITEIDTD--GSGELYLSDFLYIMSKRYENL---TVEDEVILAFKVFDKDGSGFIHENEFRQIMTE 128
            :.....:  .:.::....||.:|.....|.   :.|| .:...:||||:|:|.:...|.|.::..
 Frog    91 LGNPSAEEMNAKKIEFEQFLPMMQAVANNKDQGSFED-FVEGLRVFDKEGNGTVMGAELRHVLAT 154

  Fly   129 YGDEMEEDEIEEMIR-DADANTELKIDYVRFVTMMM 163
            .|::|.|:|:|.::. ..|:|.  .|:|..||..:|
 Frog   155 LGEKMREEEVEALLAGQEDSNG--CINYEAFVKHIM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 39/147 (27%)
EFh 28..90 CDD:298682 15/63 (24%)
EFh 64..127 CDD:238008 15/67 (22%)
EFh 101..163 CDD:298682 19/62 (31%)
myl1NP_988954.1 PTZ00184 41..189 CDD:185504 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.