DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG13898

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:142 Identity:40/142 - (28%)
Similarity:72/142 - (50%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLS 83
            :.|.::.|:|...||.|.|.:....|....|.:.:|.:..|..|:||..|...::.|.:|.:.|:
  Fly     6 YILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLT 70

  Fly    84 DFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADAN 148
            ||:.:|:|.|..:...|.:..|:..||.|..|.:...|.|.:....|:::.::|..|:.|.||.:
  Fly    71 DFIDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVD 135

  Fly   149 TELKIDYVRFVT 160
            .:..|::..|.|
  Fly   136 GDGVINFRDFCT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 40/140 (29%)
EFh 28..90 CDD:298682 18/61 (30%)
EFh 64..127 CDD:238008 19/62 (31%)
EFh 101..163 CDD:298682 16/60 (27%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 38/137 (28%)
EFh 18..77 CDD:298682 17/58 (29%)
EFh 88..148 CDD:238008 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.