DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and TpnC47D

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster


Alignment Length:166 Identity:47/166 - (28%)
Similarity:85/166 - (51%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEI 65
            ||:.|             ..|..||:...:.||..||......||.:::.|.||.:. .|.:.:|
  Fly     1 MDNID-------------EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQI 51

  Fly    66 QD-YITEIDTDGSGELYLSDFLYIMSK---RYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIM 126
            .| .|.|:|.|.||.|...:|:.:.:|   ..::..::.|:..||:::||.|:|:|..:..::|:
  Fly    52 LDELIDEVDEDKSGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEIL 116

  Fly   127 TEYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMM 162
            .|..|::.|.|::.||.:.|::....:|:..|:.||
  Fly   117 KELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 44/146 (30%)
EFh 28..90 CDD:298682 20/62 (32%)
EFh 64..127 CDD:238008 20/66 (30%)
EFh 101..163 CDD:298682 20/62 (32%)
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.