DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and azot

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:130 Identity:44/130 - (33%)
Similarity:77/130 - (59%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLT 97
            |.:.|.||...|..|.:...:||:...|.:.|:|..|.|:|::|:|.:...:|..::.::..:..
  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRDTN 80

  Fly    98 VEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMM 162
            .|||:..||::||||.:|:|...|.:.:.|..|.::.:||:|||||:.|.:.:..::|..||.||
  Fly    81 HEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFVNMM 145

  Fly   163  162
              Fly   146  145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 44/130 (34%)
EFh 28..90 CDD:298682 17/56 (30%)
EFh 64..127 CDD:238008 20/62 (32%)
EFh 101..163 CDD:298682 25/62 (40%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 44/130 (34%)
EFh 12..72 CDD:238008 17/55 (31%)
EFh 84..146 CDD:238008 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.