DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and TpnC4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:70/146 - (47%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYI 88
            |||:....||..||.|.|..|....:...|..:........::..|.|:|...:|:|..|.|..:
  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73

  Fly    89 MSKRYENLTVEDEVIL-------AFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDAD 146
            .::..|   ||::|..       ||:|:||:|.|::.....|.|:.|..|::...:::.:|.:.|
  Fly    74 AARFIE---VEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEID 135

  Fly   147 ANTELKIDYVRFVTMM 162
            |:....:|:..|:.:|
  Fly   136 ADGSGTVDFDEFMQVM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 39/146 (27%)
EFh 28..90 CDD:298682 15/61 (25%)
EFh 64..127 CDD:238008 20/69 (29%)
EFh 101..163 CDD:298682 18/69 (26%)
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 39/146 (27%)
EFh 14..75 CDD:238008 15/60 (25%)
EFh 90..152 CDD:238008 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.