DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and TpnC25D

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:144 Identity:32/144 - (22%)
Similarity:73/144 - (50%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFL 86
            :||::.....||.:||......|....|:..|.::.....::|:|..|.:.|.:.:|::....|.
  Fly     3 DDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFC 67

  Fly    87 YIMSKRYEN---LTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADAN 148
            .|.:...|.   ..::.|:..||:::|::|:|:|..:..::|:....|::...:::.:|.:.|.:
  Fly    68 SIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTD 132

  Fly   149 TELKIDYVRFVTMM 162
            ....:|:..|:.||
  Fly   133 GSGTVDFDEFMEMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 32/144 (22%)
EFh 28..90 CDD:298682 14/61 (23%)
EFh 64..127 CDD:238008 16/65 (25%)
EFh 101..163 CDD:298682 15/62 (24%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.