DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and zgc:153867

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_017209013.1 Gene:zgc:153867 / 337226 ZFINID:ZDB-GENE-030131-9170 Length:209 Species:Danio rerio


Alignment Length:180 Identity:49/180 - (27%)
Similarity:82/180 - (45%) Gaps:29/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SPP---PEVR--------------TVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRA 55
            |||   ||::              |:.: ..:::|:.:.:.||.|||......|......|.:||
Zfish    33 SPPKSAPELKPRMLRPSDSPFDPSTLES-DFSEDQILEFKEAFLLFDRTGDGKITYNQCGDVMRA 96

  Fly    56 VAHNPPENEIQDYITEIDTDGSGELYLSDF------LYIMSKRYENLTVEDEVILAFKVFDKDGS 114
            :..||...|:...:.....:......| ||      |..::|..:..|.|| .:...:||||:|:
Zfish    97 LGQNPVNAEVLKVLGNPKAEEMNHKLL-DFEQFLPMLQAIAKNKDQGTFED-FVEGLRVFDKEGN 159

  Fly   115 GFIHENEFRQIMTEYGDEMEEDEIEEMIR-DADANTELKIDYVRFVTMMM 163
            |.:...|.|.::|..|::|.|:|:|.::. ..|||.  .|:|...|.|:|
Zfish   160 GTVMGAELRHVLTTLGEKMTEEEVETLLAGHEDANG--CINYEELVRMVM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 42/148 (28%)
EFh 28..90 CDD:298682 16/67 (24%)
EFh 64..127 CDD:238008 17/68 (25%)
EFh 101..163 CDD:298682 21/62 (34%)
zgc:153867XP_017209013.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.