DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG11638

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:217 Identity:57/217 - (26%)
Similarity:97/217 - (44%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDFDFSSPP----PEVRT--------------------------------VHTHTLNDE------ 24
            ||::.||.|    |..||                                :...||:..      
  Fly   145 DDYEQSSKPEGRRPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKG 209

  Fly    25 QLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIM 89
            |:::...||.|||.|....|..:.|...:|::.......|:|:.:.|||.||.|.:...:|:.|:
  Fly   210 QMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDIL 274

  Fly    90 SKRYENLTVED------------EVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMI 142
            |    |:|.||            |:..||:||||...|:|..::.|.::...|::::|::||:||
  Fly   275 S----NMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMI 335

  Fly   143 RDADANTELKIDYVRFVTMMME 164
            ::.|.:.:.:||:..||..:.|
  Fly   336 KEVDVDGDGRIDFYEFVHALGE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 47/159 (30%)
EFh 28..90 CDD:298682 19/61 (31%)
EFh 64..127 CDD:238008 25/74 (34%)
EFh 101..163 CDD:298682 21/61 (34%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 19/61 (31%)
EF-hand_7 215..274 CDD:290234 18/58 (31%)
EFh 294..355 CDD:238008 21/60 (35%)
EF-hand_7 295..355 CDD:290234 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.