DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Calml3

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001012054.1 Gene:Calml3 / 307100 RGDID:1305499 Length:149 Species:Rattus norvegicus


Alignment Length:143 Identity:55/143 - (38%)
Similarity:95/143 - (66%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |.:||:.:.:.||:|||.|....|..:.|...:|::..||.|.|:||.:.|||.||:|.:...:|
  Rat     5 LTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQDMVNEIDKDGNGTVDFPEF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |.:||::.::...|:|:..||:||||||:||:...|.|.:||..|:::.::|::|||:.||.:.:
  Rat    70 LTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIQAADTDGD 134

  Fly   151 LKIDYVRFVTMMM 163
            .:::|..||.|::
  Rat   135 GQVNYEEFVHMLV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 55/141 (39%)
EFh 28..90 CDD:298682 23/61 (38%)
EFh 64..127 CDD:238008 27/62 (44%)
EFh 101..163 CDD:298682 26/61 (43%)
Calml3NP_001012054.1 PTZ00184 1..149 CDD:185504 55/143 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.