DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Tnnc2

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001032428.1 Gene:Tnnc2 / 296369 RGDID:1311973 Length:160 Species:Rattus norvegicus


Alignment Length:145 Identity:45/145 - (31%)
Similarity:82/145 - (56%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |::|.:.:.:|||.:||.|....|.:|.|...:|.:...|.:.|:...|.|:|.||||.:...:|
  Rat    12 LSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEF 76

  Fly    86 LYIMSKRYENLT---VEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADA 147
            |.:|.::.:...   .|:|:...|::||::..|:|...|..:|....|:.:.::|||.:::|.|.
  Rat    77 LVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDK 141

  Fly   148 NTELKIDYVRFVTMM 162
            |.:.:||:..|:.||
  Rat   142 NNDGRIDFDEFLKMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 45/145 (31%)
EFh 28..90 CDD:298682 21/61 (34%)
EFh 64..127 CDD:238008 20/65 (31%)
EFh 101..163 CDD:298682 20/62 (32%)
Tnnc2NP_001032428.1 PTZ00184 12..156 CDD:185504 43/143 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.