DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Efcab2

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_038946462.1 Gene:Efcab2 / 289280 RGDID:1308593 Length:179 Species:Rattus norvegicus


Alignment Length:170 Identity:45/170 - (26%)
Similarity:88/170 - (51%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 THTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEI-DTDGSGELY 81
            |..:..|..|..:.||.:||.::...:.::.:...:|::..:|.|.|:.|:|.|: :.:.:|.:.
  Rat    10 TEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIR 74

  Fly    82 LSDFLYIMS-----KRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTE------------- 128
            ...|:.:|:     |||..: .||.::.||:|.|....||:.::|..:.|||             
  Rat    75 FEKFIPVMTTVLLEKRYRPI-AEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLEL 138

  Fly   129 --YGDEMEEDEIEEMIR---DADANTELKIDYVRFVTMMM 163
              :|:...::|:|||:.   |.::||   |:|..::|||:
  Rat   139 ELHGEPFSQEEMEEMLSAAIDPESNT---INYRDYITMMV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 43/165 (26%)
EFh 28..90 CDD:298682 13/62 (21%)
EFh 64..127 CDD:238008 19/68 (28%)
EFh 101..163 CDD:298682 22/79 (28%)
Efcab2XP_038946462.1 PTZ00184 22..175 CDD:185504 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.