DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cam2

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:44/147 - (29%)
Similarity:71/147 - (48%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPE-------NEIQDYITEIDTDGSGELY 81
            ||..:.:.||.|:|.|...:||...:...||::..|..:       ||:.|.|.|          
pombe     6 EQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNELGDAIDE---------- 60

  Fly    82 LSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDAD 146
             ..|:..:|.:......|:|.|.||:|||||.||:|...:|...|...|:::.::|::.|:::||
pombe    61 -KKFMSFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEAD 124

  Fly   147 ANTELKIDYVRFVTMMM 163
            .......||..||..:|
pombe   125 PTNSGSFDYYDFVQRIM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 43/145 (30%)
EFh 28..90 CDD:298682 16/68 (24%)
EFh 64..127 CDD:238008 20/62 (32%)
EFh 101..163 CDD:298682 23/61 (38%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 44/147 (30%)
EFh 10..105 CDD:298682 31/105 (30%)
EFh 79..141 CDD:238008 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.