DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CG30378

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:83/146 - (56%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSD 84
            :|.:.|:::...||:|:|.:.:..:.::.|...:||:..:..|.||.|...|.:.|..|::...|
  Fly     4 SLTEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKD 68

  Fly    85 FLYIMSKRYENLTVEDEVIL---AFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDAD 146
            |||:||||.|.   ::.::.   |||:||:........||.|.:||..|::|.|:::.|:.:|.|
  Fly    69 FLYVMSKRLEE---QNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDID 130

  Fly   147 ANTELKIDYVRFVTMM 162
            .:.:.||.:..|||.|
  Fly   131 QDKDGKISFNEFVTAM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 47/145 (32%)
EFh 28..90 CDD:298682 18/61 (30%)
EFh 64..127 CDD:238008 23/65 (35%)
EFh 101..163 CDD:298682 22/65 (34%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 47/146 (32%)
EFh 12..74 CDD:238008 18/61 (30%)
EFh 86..147 CDD:238008 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.