DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Myl6b

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:164 Identity:45/164 - (27%)
Similarity:76/164 - (46%) Gaps:24/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNP-----------PE 62
            ||.::..| ....|.:||::...||.|||......|......|.:||:..||           |:
Mouse    49 PPVDLSKV-VIEFNKDQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPK 112

  Fly    63 N-EIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIM 126
            | |::....:.:|       ....|..::|..:..|.|| .:...:||||:|:|.:...|.|.::
Mouse   113 NEELKSRRVDFET-------FLPMLQAVAKNRDQGTYED-YLEGLRVFDKEGNGKVMGAELRHVL 169

  Fly   127 TEYGDEMEEDEIEEMIR-DADANTELKIDYVRFV 159
            |..|::|.|:|:|.::. ..|:|.  .|:|..|:
Mouse   170 TTLGEKMTEEEVETVLAGHEDSNG--CINYEAFL 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 42/152 (28%)
EFh 28..90 CDD:298682 16/73 (22%)
EFh 64..127 CDD:238008 15/62 (24%)
EFh 101..163 CDD:298682 19/60 (32%)