DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cal-5

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:135 Identity:35/135 - (25%)
Similarity:61/135 - (45%) Gaps:4/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKR 92
            |.:..|..||.:....|..:.||..::.:..:|.|:|:.......|.|..|.:...:||.|....
 Worm    22 DLKGIFREFDLNGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDFQEFLVIAKAN 86

  Fly    93 YENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKIDYVR 157
            ..:|:::    ..|:..|.||.|:|..:|.|......|..:.:.:|:.:.|..|.|.:.||::..
 Worm    87 PLSLSLK----AVFEELDVDGDGYITRSELRTAFQRMGHSLSDQDIKAIYRHVDQNNDGKINFQE 147

  Fly   158 FVTMM 162
            |..||
 Worm   148 FCEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 35/135 (26%)
EFh 28..90 CDD:298682 16/61 (26%)
EFh 64..127 CDD:238008 16/62 (26%)
EFh 101..163 CDD:298682 18/62 (29%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 35/135 (26%)
EFh 22..84 CDD:238008 16/61 (26%)
EFh 92..153 CDD:238008 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.