DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and T09B4.4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_491778.2 Gene:T09B4.4 / 188316 WormBaseID:WBGene00020378 Length:142 Species:Caenorhabditis elegans


Alignment Length:112 Identity:22/112 - (19%)
Similarity:51/112 - (45%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDG 113
            ||..||::.::|..::...|..:::   ...:..:.||.|......:.....|:|.|....|::.
 Worm    32 LRCALRSLGYSPTASKTDIYFKKLN---KKPIEFATFLDICKDEQNSPNPLTEIIKALSGLDRNK 93

  Fly   114 SGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADAN----TELKIDYV 156
            :..:...|...|::..|::|..:||:.::...:.|    .:..|:|:
 Worm    94 TRAMPSRELAAILSHVGEQMSPEEIKYLLSKVEVNGMVPHQALIEYI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 22/112 (20%)
EFh 28..90 CDD:298682 9/40 (23%)
EFh 64..127 CDD:238008 10/62 (16%)
EFh 101..163 CDD:298682 13/60 (22%)
T09B4.4NP_491778.2 PTZ00183 5..129 CDD:185503 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.