DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and K03A1.4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001041263.2 Gene:K03A1.4 / 186916 WormBaseID:WBGene00019352 Length:184 Species:Caenorhabditis elegans


Alignment Length:138 Identity:35/138 - (25%)
Similarity:65/138 - (47%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIM 89
            ::::.:.||..||.:|...|.|..|...::.....|.:.|::..:...|.|.:|.:...:|.::|
 Worm    43 KIEEYKRAFNFFDANNDGRITIDELEKAMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLM 107

  Fly    90 SKRYE-NLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYG--DEMEEDEIEEMIRDADANTEL 151
            :.... |....|::...|.:||||..|||.:.|...|:.|..  .......:|::..:||.:.:.
 Worm   108 NGTASMNQYTYDQLREQFDMFDKDKDGFIEKMEMLSIVRELSLQASFPRQVVEQLFNEADIDGDG 172

  Fly   152 KIDYVRFV 159
            ||.:..||
 Worm   173 KISFEEFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 35/138 (25%)
EFh 28..90 CDD:298682 14/61 (23%)
EFh 64..127 CDD:238008 18/63 (29%)
EFh 101..163 CDD:298682 18/61 (30%)
K03A1.4NP_001041263.2 PTZ00184 43..180 CDD:185504 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.