DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cal-8

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_495043.1 Gene:cal-8 / 184373 WormBaseID:WBGene00017394 Length:145 Species:Caenorhabditis elegans


Alignment Length:141 Identity:39/141 - (27%)
Similarity:73/141 - (51%) Gaps:2/141 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCE--AAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFL 86
            :.||:.|  ..|..||.:....|..:.|...|..:......::|:..|.:.|.||:|.:.:.:||
 Worm     2 DSLKEAEIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNGCIDIDEFL 66

  Fly    87 YIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTEL 151
            .::.::..:...|.|:...|.||||:|.|.|..::...:|.:.|:::.|.|.:|||:..|.:.:.
 Worm    67 NVLRRQICDPKEERELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDHDG 131

  Fly   152 KIDYVRFVTMM 162
            .||:..||.::
 Worm   132 MIDFQEFVNII 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 39/141 (28%)
EFh 28..90 CDD:298682 15/63 (24%)
EFh 64..127 CDD:238008 18/62 (29%)
EFh 101..163 CDD:298682 21/62 (34%)
cal-8NP_495043.1 PTZ00184 7..142 CDD:185504 37/134 (28%)
EFh 8..70 CDD:238008 15/61 (25%)
EFh 81..143 CDD:238008 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.