DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and B0563.7

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:161 Identity:50/161 - (31%)
Similarity:88/161 - (54%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEI 72
            |.|.:::..:|.    ::||:....|.:||.|.:..|..:.|:..:.::..:..:.||.:.|.|:
 Worm    36 SQPEDIQMKYTR----KELKEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEV 96

  Fly    73 DTDGSGELYLSDFLYIMSKRYENL---TVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEME 134
            |.||:||:...:|...| |:.:|:   |.|:.:...|::||:|.:|.|.||||:.|..|:||  .
 Worm    97 DADGNGEIDFEEFCACM-KKSQNIVKSTNEELIRECFEIFDQDRNGIITENEFKYIAKEFGD--F 158

  Fly   135 EDEIEEMI---RDADANTELKIDYVRFVTMM 162
            :||:.|.:   .|..||..|..|  :|.|::
 Worm   159 DDELAEKVFRELDVSANGHLSAD--QFATIV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 47/148 (32%)
EFh 28..90 CDD:298682 16/61 (26%)
EFh 64..127 CDD:238008 26/65 (40%)
EFh 101..163 CDD:298682 24/65 (37%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 46/145 (32%)
EFh 52..114 CDD:238008 17/62 (27%)
EFh 88..153 CDD:238008 26/65 (40%)
EFh 128..187 CDD:238008 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.