DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and E02A10.3

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:146 Identity:41/146 - (28%)
Similarity:75/146 - (51%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFL 86
            ::|:|::....|.:||.|.:..|.|..|...::.:......:|:...|.|:|..|:.::...:|.
 Worm   132 SEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFC 196

  Fly    87 YIMSKRYENLTVE----DEVIL-AFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDAD 146
            .:|.:    ||::    :||:. .|.|||:..:|.|.:.:||.|:.|.||..:...|:|:..:||
 Worm   197 VVMRR----LTMKKSNWNEVVKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEAD 257

  Fly   147 ANTELKIDYVRFVTMM 162
            .:....|||..|..|:
 Worm   258 VDGNGVIDYDEFTYMV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 41/146 (28%)
EFh 28..90 CDD:298682 13/61 (21%)
EFh 64..127 CDD:238008 20/67 (30%)
EFh 101..163 CDD:298682 23/63 (37%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 40/144 (28%)
EF-hand motif 140..167 CDD:320054 7/26 (27%)
EF-hand motif 175..203 CDD:320054 6/31 (19%)
EF-hand motif 208..241 CDD:320054 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.