DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Myl3

DIOPT Version :10

Sequence 1:NP_651431.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_034989.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:151 Identity:46/151 - (30%)
Similarity:72/151 - (47%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFD--DDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGEL--YLSD 84
            ||:::.:.||.|||  ......|......|.|||:..||.:.|:   :..:......||  .:.|
Mouse    58 EQIEEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEV---LRVLGKPKQEELNSKMMD 119

  Fly    85 F------LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEE-MI 142
            |      |..:||..:..|.|| .:...:||||:|:|.:...|.|.::...|:.:.|||:|: |.
Mouse   120 FETFLPMLQHISKNKDTGTYED-FVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMA 183

  Fly   143 RDADANTELKIDYVRFVTMMM 163
            ...|:|.  .|:|..||..:|
Mouse   184 GQEDSNG--CINYEAFVKHIM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_651431.1 PTZ00184 21..163 CDD:185504 45/149 (30%)
Myl3NP_034989.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTZ00184 53..203 CDD:185504 46/151 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.