DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cal-3

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:139 Identity:52/139 - (37%)
Similarity:81/139 - (58%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |.:|::.:.:.||.|||.|....|.||.|...:||:..||.|.::.:.|.::|.||:|::...:|
 Worm    93 LTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEFPEF 157

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            . :|.||....|..:.:..|||:||:||:|.|..|||:..|...|...:|.|:|||:.:.|.:..
 Worm   158 C-VMMKRIMKETDSEMIREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDGN 221

  Fly   151 LKIDYVRFV 159
            .:|||..||
 Worm   222 GEIDYEEFV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 52/139 (37%)
EFh 28..90 CDD:298682 21/61 (34%)
EFh 64..127 CDD:238008 22/62 (35%)
EFh 101..163 CDD:298682 25/59 (42%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 52/139 (37%)
EFh 100..162 CDD:238008 22/62 (35%)
EFh 172..234 CDD:238008 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.990

Return to query results.
Submit another query.