DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and mlc-5

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_499813.1 Gene:mlc-5 / 176796 WormBaseID:WBGene00011734 Length:142 Species:Caenorhabditis elegans


Alignment Length:142 Identity:45/142 - (31%)
Similarity:74/142 - (52%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYI 88
            :.|.||...||.||....:.|.::.:.|.|||:..||.|.||...:...|.:  ..|...||:.|
 Worm     2 DDLADCREVFAYFDSKGDERISVQQVGDVLRALGQNPTEAEIHKCVGSFDRE--ARLSFEDFVPI 64

  Fly    89 ---MSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMI---RDADA 147
               :||..|..||| |.:.....|||:|:|.|:..|.|.::|..|:.:.::::::::   .|:..
 Worm    65 FQSVSKNREKHTVE-EFVEGLSHFDKEGNGMINVAELRHLLTTLGERLSDEDVDQLLSGHNDSHG 128

  Fly   148 NTELKIDYVRFV 159
            |..:. |:||.|
 Worm   129 NVNIS-DFVRAV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 45/142 (32%)
EFh 28..90 CDD:298682 21/64 (33%)
EFh 64..127 CDD:238008 22/65 (34%)
EFh 101..163 CDD:298682 17/62 (27%)
mlc-5NP_499813.1 PTZ00184 2..140 CDD:185504 45/142 (32%)
EFh 6..62 CDD:298682 19/57 (33%)
EFh 79..140 CDD:238008 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.