DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CALML6

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:152 Identity:46/152 - (30%)
Similarity:79/152 - (51%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDG 76
            :..|..|..|:.||:|:.:..|.:||::....:....|...:..:..||.::|:.....::|.|.
Human    43 QTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDN 107

  Fly    77 SGELYLSDFLYIMSKRYENL-TVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEE 140
            .|......||.:|...:|.. ..|.|:..||:||||:|.|:|..|..:.::...|:.:.|.|.|:
Human   108 KGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ 172

  Fly   141 MIRDADANTELKIDYVRFVTMM 162
            |:::||.:.:..|||..||.||
Human   173 MMKEADKDGDRTIDYEEFVAMM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 44/143 (31%)
EFh 28..90 CDD:298682 12/61 (20%)
EFh 64..127 CDD:238008 20/63 (32%)
EFh 101..163 CDD:298682 25/62 (40%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 45/147 (31%)
EFh 59..120 CDD:238008 12/60 (20%)
EFh 133..195 CDD:238008 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.