DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and MYL6B

DIOPT Version :10

Sequence 1:NP_651431.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_002466.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:157 Identity:46/157 - (29%)
Similarity:77/157 - (49%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEID 73
            ||.::..| ....|.:||::.:.||.|||......|......|.:||:..||...|:...:....
Human    50 PPVDLSKV-VIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPK 113

  Fly    74 TD--GSGELYLSDFLYIMSKRYENL---TVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEM 133
            :|  .|..:....||.::....:|.   |.|| .:..|:||||:|:|.:...|.|.::|..|::|
Human   114 SDELKSRRVDFETFLPMLQAVAKNRGQGTYED-YLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM 177

  Fly   134 EEDEIEEMIR-DADANTELKIDYVRFV 159
            .|:|:|.::. ..|:|.  .|:|..|:
Human   178 TEEEVETVLAGHEDSNG--CINYEAFL 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_651431.1 PTZ00184 21..163 CDD:185504 43/145 (30%)