DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Calm1

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001300863.1 Gene:Calm1 / 12313 MGIID:88251 Length:197 Species:Mus musculus


Alignment Length:153 Identity:60/153 - (39%)
Similarity:98/153 - (64%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDT 74
            ||..|......|.:||:.:.:.||:|||.|....|..|.|...:|::..||.|.|:||.|.|:|.
Mouse    42 PPGGRGAGADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 106

  Fly    75 DGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIE 139
            ||:|.:...:||.:|:::.::...|:|:..||:||||||:|:|...|.|.:||..|:::.::|::
Mouse   107 DGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVD 171

  Fly   140 EMIRDADANTELKIDYVRFVTMM 162
            ||||:||.:.:.:::|..||.||
Mouse   172 EMIREADIDGDGQVNYEEFVQMM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 57/142 (40%)
EFh 28..90 CDD:298682 24/61 (39%)
EFh 64..127 CDD:238008 26/62 (42%)
EFh 101..163 CDD:298682 28/62 (45%)
Calm1NP_001300863.1 PTZ00184 50..197 CDD:185504 57/145 (39%)
EFh 60..122 CDD:238008 24/61 (39%)
EFh 133..195 CDD:238008 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.