DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and calm2

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001363414.1 Gene:calm2 / 100496298 XenbaseID:XB-GENE-976642 Length:149 Species:Xenopus tropicalis


Alignment Length:142 Identity:57/142 - (40%)
Similarity:95/142 - (66%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |.:||:.:.:.||:|||.|....|..|.|...:|::..||.|.|:||.|.|:|.||:|.:...:|
 Frog     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |.:|:::.::...|:|:..||:||||||:|:|...|.|.:||..|:::.::|::||||:||.:.:
 Frog    70 LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGD 134

  Fly   151 LKIDYVRFVTMM 162
            .:::|..||.||
 Frog   135 GQVNYEEFVQMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 57/142 (40%)
EFh 28..90 CDD:298682 24/61 (39%)
EFh 64..127 CDD:238008 26/62 (42%)
EFh 101..163 CDD:298682 28/62 (45%)
calm2NP_001363414.1 PTZ00184 1..149 CDD:185504 57/142 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.