powered by:
Protein Alignment CG5024 and LOC100493285
DIOPT Version :9
Sequence 1: | NP_001163736.1 |
Gene: | CG5024 / 43117 |
FlyBaseID: | FBgn0039373 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002936019.3 |
Gene: | LOC100493285 / 100493285 |
-ID: | - |
Length: | 214 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 34/66 - (51%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 DEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMMME 164
:|:...|.:.|:|..|.|..::........|..:...|:|||:.:||.|.:..:|...|:.:|::
Frog 146 NELKKGFSLIDQDKDGKISMSDLNAASKMAGIHLSRQELEEMMAEADQNGDRAVDISEFIEIMLK 210
Fly 165 T 165
|
Frog 211 T 211
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1470794at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.