DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and YOP1

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_015353.1 Gene:YOP1 / 856140 SGDID:S000006232 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:54/160 - (33%)
Similarity:83/160 - (51%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SQVQRFFNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVF---GWCAQ 67
            ||:::|...|..  ||.|:           .||.||.:.: :..|..:.|....|:|   |...:
Yeast    10 SQMKQFDTKYSG--NRILQ-----------QLENKTNLPK-SYLVAGLGFAYLLLIFINVGGVGE 60

  Fly    68 LLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFL 132
            :|.|..|.:.|||:|:..:::.|..||.:.|.||:.|...:||||:...:..:|||||.||..||
Yeast    61 ILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFL 125

  Fly   133 IWCMLPTERNGSTLIYHKLVRP----YFLK 158
            |:..|| :..|:.:||.|:|.|    |.|:
Yeast   126 IYIALP-QTGGARMIYQKIVAPLTDRYILR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 35/87 (40%)
YOP1NP_015353.1 YOP1 1..180 CDD:227385 54/160 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I2017
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 95 1.000 Inparanoid score I1507
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm46692
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.