DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and HVA22G

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001321035.1 Gene:HVA22G / 843904 AraportID:AT1G75700 Length:206 Species:Arabidopsis thaliana


Alignment Length:148 Identity:35/148 - (23%)
Similarity:51/148 - (34%) Gaps:47/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIR----WLIYW--------- 101
            :||.|.....:|||:.           ||||.....:|  ..:.:|:    |..||         
plant     2 IGSFLTRGLLMVFGYA-----------YPAYECFKTVE--LNKPEIQQLQFWCQYWYMHTFYPLS 53

  Fly   102 VTF--------------------GIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTL 146
            :||                    ...|:.|.....|.|.:|.|...|..|.|:...| :..|:|.
plant    54 ITFLGSYINLASFHSKHLCRIIVAALTIFERIGDALVSWLPMYSEAKLAFFIYLWFP-KTKGTTY 117

  Fly   147 IYHKLVRPYFLKLHDPVD 164
            :|....|||..|..:.:|
plant   118 VYDSFFRPYIAKHENEID 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 24/120 (20%)
HVA22GNP_001321035.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.