DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and HVA22B

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_201055.1 Gene:HVA22B / 836369 AraportID:AT5G62490 Length:167 Species:Arabidopsis thaliana


Alignment Length:128 Identity:39/128 - (30%)
Similarity:59/128 - (46%) Gaps:12/128 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VGS---ILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIE 111
            :||   ::|..|.::.|       .:|.::||.|.|:..|||.:..||.:||.||..:.:..:.|
plant     5 IGSLVKVIFKNFDVIAG-------PVISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKLFE 62

  Fly   112 FYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVDMMSAGVPKDD 174
            .....|...||.|...|.....|.:|| ..||:..:|...||.:.|..| .|::......|||
plant    63 LTFFRLLEWIPLYPYAKLALTSWLVLP-GMNGAAYLYEHYVRSFLLSPH-TVNVWYVPAKKDD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 27/87 (31%)
HVA22BNP_201055.1 TB2_DP1_HVA22 29..105 CDD:397309 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.