DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and HVA22E

DIOPT Version :10

Sequence 1:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_568744.1 Gene:HVA22E / 835144 AraportID:AT5G50720 Length:116 Species:Arabidopsis thaliana


Alignment Length:87 Identity:34/87 - (39%)
Similarity:50/87 - (57%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCM 136
            ::.:|||.|.|:..|||.:|.||.:||.||:.:...|:.|.....|...||.::..|..|:.|.:
plant    18 VVMLLYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELILQSLLEWIPIWYTAKLVFVAWLV 82

  Fly   137 LPTERNGSTLIYHKLVRPYFLK 158
            ||..| |:..||:|:||..|.|
plant    83 LPQFR-GAAFIYNKVVREQFKK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 30/76 (39%)
HVA22ENP_568744.1 TB2_DP1_HVA22 24..98 CDD:460820 28/74 (38%)

Return to query results.
Submit another query.