DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and HVA22K

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_195390.2 Gene:HVA22K / 829825 AraportID:AT4G36720 Length:200 Species:Arabidopsis thaliana


Alignment Length:101 Identity:36/101 - (35%)
Similarity:55/101 - (54%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIW 134
            |..||:..|.|.:...|||..:.:..:.||||..:|.|:::|.:...:.|..|.|:.:|..||:|
plant    41 CCSIGIGLPVYSTFKAIESGDENEQQKMLIYWAAYGSFSLVEVFTDKIISWFPLYYHVKFAFLVW 105

  Fly   135 CMLPTERNGSTLIYHKLVRPYFLKLHDPVDMMSAGV 170
            ..|||. .||..||:..:||:.|:....||.:..||
plant   106 LQLPTV-EGSKQIYNNQIRPFLLRHQARVDQLVDGV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 29/83 (35%)
HVA22KNP_195390.2 TB2_DP1_HVA22 49..125 CDD:397309 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm3308
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.