DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and HVA22D

DIOPT Version :10

Sequence 1:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_567713.1 Gene:HVA22D / 828598 AraportID:AT4G24960 Length:135 Species:Arabidopsis thaliana


Alignment Length:87 Identity:32/87 - (36%)
Similarity:52/87 - (59%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCM 136
            |:.:|||.|.|:..:||:||.||.:||.||:.:...::.|.....|...||.::.:|..|:.|.:
plant    18 IVMLLYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELILQSLIEWIPIWYTVKLVFVAWLV 82

  Fly   137 LPTERNGSTLIYHKLVRPYFLK 158
            || :..|:..||:::||..|.|
plant    83 LP-QFQGAAFIYNRVVREQFKK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 27/76 (36%)
HVA22DNP_567713.1 TB2_DP1_HVA22 24..98 CDD:460820 25/74 (34%)

Return to query results.
Submit another query.