DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and REEP4

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_079508.2 Gene:REEP4 / 80346 HGNCID:26176 Length:257 Species:Homo sapiens


Alignment Length:101 Identity:29/101 - (28%)
Similarity:56/101 - (55%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLCNII----GVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLK 128
            ::|.::    |:|.|||.|...:::...::.:||::||:.|.:|...|....:..|..|||:.:|
Human     5 MICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFISWFPFYYEIK 69

  Fly   129 CTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            ..|::|.:.|..: |::|:|.|.|.|...:....:|
Human    70 MAFVLWLLSPYTK-GASLLYRKFVHPSLSRHEKEID 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 27/89 (30%)
REEP4NP_079508.2 TB2_DP1_HVA22 19..94 CDD:308643 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.