DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and REEP5

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_016865333.1 Gene:REEP5 / 7905 HGNCID:30077 Length:257 Species:Homo sapiens


Alignment Length:143 Identity:72/143 - (50%)
Similarity:94/143 - (65%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDI 95
            |.....||.||||.|..|.:|.|...|.|||||:.|.||||:||..|||||||..|||..|:||.
Human    20 TDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDT 84

  Fly    96 RWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLH 160
            :||.|||.:|:|::.||:..:..|..|||::|||.||:|||.|:..||:.|:|.:::||:|||..
Human    85 QWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHE 149

  Fly   161 DPVDMMSAGVPKD 173
            ..:|    .|.||
Human   150 SQMD----SVVKD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 46/87 (53%)
REEP5XP_016865333.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159559
Domainoid 1 1.000 113 1.000 Domainoid score I6125
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 179 1.000 Inparanoid score I4020
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm8564
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.