DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep4

DIOPT Version :10

Sequence 1:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_006519661.1 Gene:Reep4 / 72549 MGIID:1919799 Length:293 Species:Mus musculus


Alignment Length:137 Identity:34/137 - (24%)
Similarity:58/137 - (42%) Gaps:41/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLCNII----GVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPS------------- 115
            ::|.::    |:|||||.|...::|...::.:||::||:.|.||...|.:..             
Mouse     5 MICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWSGPRIGRP 69

  Fly   116 -----------------------LLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFL 157
                                   |||...|||:..|..|::|.:.|..: |::|:|.|.|.|...
Mouse    70 WGWEGPHHHHHHHLASGSHKPLPLLTHRFPFYYEFKMAFVLWLLSPYTK-GASLLYRKFVHPSLS 133

  Fly   158 KLHDPVD 164
            :....:|
Mouse   134 RHEKEID 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 28/112 (25%)
Reep4XP_006519661.1 TB2_DP1_HVA22 19..130 CDD:460820 28/111 (25%)
PRK11675 <247..>279 CDD:183272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.