DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and reep5

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001011272.1 Gene:reep5 / 496723 XenbaseID:XB-GENE-944534 Length:189 Species:Xenopus tropicalis


Alignment Length:136 Identity:70/136 - (51%)
Similarity:94/136 - (69%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDI 95
            |...:.:|.||||.|..|.:..|...|.|||.|:.|.||||:||..||||:||..|||:||.||.
 Frog    20 TDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAYVSIKAIESATKDDDT 84

  Fly    96 RWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLH 160
            :||.|||.:|||::|||:..:..|..|||:::||.||:|||.|:..||:||||.::|||:|||..
 Frog    85 QWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHE 149

  Fly   161 DPVDMM 166
            ..:|.:
 Frog   150 GEMDRL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 50/87 (57%)
reep5NP_001011272.1 TB2_DP1_HVA22 67..144 CDD:367349 43/76 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5771
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 186 1.000 Inparanoid score I3796
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm9456
Panther 1 1.100 - - O PTHR12300
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.