DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and reep6

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_009304084.1 Gene:reep6 / 447918 ZFINID:ZDB-GENE-040912-98 Length:213 Species:Danio rerio


Alignment Length:140 Identity:61/140 - (43%)
Similarity:89/140 - (63%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDI 95
            |...:.:|||||:::..:..|:......:|:.|:.|.|:||:||.:||||.||..|||..|:||.
Zfish    23 TDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDT 87

  Fly    96 RWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLH 160
            :||.|||.:|.|:|.||:..:.....|||::.||.||:|||.|...|||.::|..:|||:|||..
Zfish    88 QWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHE 152

  Fly   161 DPVDMMSAGV 170
            ..||.|.:.:
Zfish   153 AAVDGMVSNI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 44/87 (51%)
reep6XP_009304084.1 TB2_DP1_HVA22 58..146 CDD:281172 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5859
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4006
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm6434
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.